PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G062000.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 316aa    MW: 34402.6 Da    PI: 8.228
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G062000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Sobic.005G062000.2.p 14 KGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                          79******************************99************97 PP

2Myb_DNA-binding58.11.9e-1867111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg++T+eEdel+++ ++++G++ W++Ia +++ gRt++++k++w+++
  Sobic.005G062000.2.p  67 RGNFTEEEDELIIKFHELFGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                           89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.206961IPR017930Myb domain
SMARTSM007177.4E-141363IPR001005SANT/Myb domain
SuperFamilySSF466891.02E-2913108IPR009057Homeodomain-like
PfamPF002493.0E-151461IPR001005SANT/Myb domain
CDDcd001677.66E-111661No hitNo description
PROSITE profilePS5129428.68462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2865116IPR009057Homeodomain-like
SMARTSM007174.0E-1866114IPR001005SANT/Myb domain
PfamPF002499.1E-1767111IPR001005SANT/Myb domain
CDDcd001671.69E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGRSPCCEQA HTNKGAWTKE EDQRLIAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK FHELFGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLARG  120
TDPQTHRPLA AASGAPAGQQ HYQLEQQMQA AAAGVGTVGH PHHHRHHQQQ HQAPQQQDVI  180
SNSPEAACTS RSSDDEPRSS TPTPPPPPRR HLDIDLNLSI SLSAYQPPEE ESGSIKSPLM  240
MMMMKQEEET AAASAAGGTN AAAAVCLCLN SLGYRPGVEC ACGGNGGVGS SSQSQQWARS  300
FLQAAAAATP CYRGQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0696560.0BT069656.1 Zea mays full-length cDNA clone ZM_BFb0205E08 mRNA, complete cds.
GenBankKJ7268020.0KJ726802.1 Zea mays clone pUT3029 MYB transcription factor (MYB67) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677677.11e-150PREDICTED: uncharacterized protein LOC100384270 isoform X1
SwissprotQ9SZP11e-88MYB4_ARATH; Transcription repressor MYB4
TrEMBLK7UP121e-150K7UP12_MAIZE; MYB transcription factor
STRINGGRMZM2G089244_P011e-150(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.19e-88myb domain protein 4